Tau Peptide (337-368) (Repeat 4 Domain) trifluoroacetate salt,CAS: 330456-27-4

H-Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn-OH trifluoroacetate salt

Product description

Tau Peptide (337-368) (Repeat 4 Domain) trifluoroacetate salt ,CAS: 330456-27-4  is a Tau Peptide.It can be applied to Study on Alzheimer disease.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	330456-27-4
Sequence	VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Molecular Formula	C₁₅₀H₂₄₈N₄₄O₅₀
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Tau Peptide (337-368) (Repeat 4 Domain) trifluoroacetate salt

Related Product

• tau-peptide-379-408-trifluoroacetate-salt